PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G144200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 322aa    MW: 34328.3 Da    PI: 7.1008
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G144200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65e-171462148
                        TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                        +g+W++eEd +l+++++++G+g +W + +++ g++R++k+c++rw++yl
  Sevir.2G144200.1.p 14 KGPWSPEEDIKLKEYIHKHGTGgNWIALPHKAGLKRCGKSCRLRWLNYL 62
                        79*********************************************97 PP

2Myb_DNA-binding38.62.5e-1269111246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g ++ +Ed ++ ++++  G++ W+ Ia+ ++ gRt++++k++w++
  Sevir.2G144200.1.p  69 GDFSDDEDRIICNLFATIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                         679******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.27962IPR017930Myb domain
SuperFamilySSF466899.77E-2712109IPR009057Homeodomain-like
SMARTSM007175.8E-131364IPR001005SANT/Myb domain
PfamPF002492.6E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-241569IPR009057Homeodomain-like
CDDcd001673.89E-101662No hitNo description
PROSITE profilePS5129421.79363117IPR017930Myb domain
SMARTSM007171.0E-1167115IPR001005SANT/Myb domain
PfamPF002494.8E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-2370118IPR009057Homeodomain-like
CDDcd001672.07E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRAPCCDKA TVKKGPWSPE EDIKLKEYIH KHGTGGNWIA LPHKAGLKRC GKSCRLRWLN  60
YLRPNIKHGD FSDDEDRIIC NLFATIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMHG  120
VQPYTTHMHN HCSSMKQQQL LFLTASAPAA PPEAACPLSL QHLSSPHDYS HHYISSYGSS  180
NSSTSLLSAA AAAGSHGGLL NGEHQTMSTS CLDSDGGLGL YFDELCATVT TSSGVHGQGL  240
GMESFILGGF QLQEDHHKAM LVAGAGAGAA NQLNQQYSAA TSGCYDDEAK PLVSVTGGGD  300
GAGGTSSSFF YGSSYSNDDE S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-26141174105MYB PROTO-ONCOGENE PROTEIN
1mse_C6e-26141174105C-Myb DNA-Binding Domain
1msf_C6e-26141174105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004956269.10.0PREDICTED: myb-related protein Hv1-like
TrEMBLK3ZVB30.0K3ZVB3_SETIT; Uncharacterized protein
STRINGSi030544m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-75myb domain protein 36